ID   LISOD      standard; DNA; PRO; 756 BP.
XX
AC   X64011; S78972;
XX
NI   g44010
XX
DT   28-APR-1992 (Rel. 31, Created)
DT   30-JUN-1993 (Rel. 36, Last updated, Version 6)
XX
DE   L.ivanovii sod gene for superoxide dismutase
XX.
KW   sod gene; superoxide dismutase.
XX
OS   Listeria ivanovii
OC   Eubacteria; Firmicutes; Low G+C gram-positive bacteria; Bacillaceae;
OC   Listeria.
XX
RN   [1]
RA   Haas A., Goebel W.;
RT   "Cloning of a superoxide dismutase gene from Listeria ivanovii by 
RT   functional complementation in Escherichia coli and 
RT   characterization of the gene product."; 
RL   Mol. Gen. Genet. 231:313-322(1992).
XX
RN   [2]
RP   1-756
RA   Kreft J.;
RT   ;
RL   Submitted (21-APR-1992) on tape to the EMBL Data Library by:
RL   J. Kreft, Institut f. Mikrobiologie, Universitaet Wuerzburg,
RL   Biozentrum Am Hubland, 8700 Wuerzburg, FRG
XX
DR   SWISS-PROT; P28763; SODM_LISIV.
XX
FH   Key           	Location/Qualifiers
FH
FT   source        	1..756
FT                 	/organism="Listeria ivanovii"
FT                 	/strain="ATCC 19119"
FT   RBS           	95..100
FT                 	/gene="sod"
FT   CDS           	109..717
FT                 	/gene="sod"
FT                 	/EC_number="1.15.1.1"
FT                 	/product="superoxide dismutase"
FT                 	/db_xref="PID:g44011"
FT                 	/db_xref="SWISS-PROT:P28763"
FT			/translation="MTYELPKLPYTYDALEPNFDKETMEIHYTKHHNIYVTKLNEAV
FT			SGHAELASKPGEELVANLDSVPEEIRGAVRNHGGGHANHTLFWSSLSPNGGGAPTGN
FT			LKAAIESEFGTFDEFKEKFNAAAAARFGSGWAWLVVNNGKLEIVSTANQDSPLSEGK
FT			TPVLGLDVWEHAYYLKFQNRRPEYIDTFWNVINWDERNKRFDAAK*"
FT   terminator    	723..746
FT                 	/gene="sod"
XX
SQ   Sequence 756 BP; 247 A; 136 C; 151 G; 222 T; 0 other;