INPUT QUERY

TYPE	DNA
TARGET	PDB
METHOD	SW -G 13 
MATRIX	BLOSUM 62 
SCORE	25 
ALIGN	25 -G  -g
SEQ
AGTCTGTGTGCACTGCAAAACGTCGTACTGCAGTCTGTGTGCACTGCAAAAGTCGTCGTGACACACACTGCT
GCGTACATGCACTGCTGACTGCGTACGAGAGTCTGATATGCTGCACGTCGTACTGCAGTCTGTGTGCACTGC
AAAACGTCGTACTGCTGACACACACTGCTGCGTACATGCACTGCTGTGACACACACTGCTGCGTACATGCAC
TGCTGTGACACACACTGCTGCGTACATGCACTGCTGTGACACACACTGCTGCGTACATGCACTGCTGTGACA
CACACTGCTGCGTACATGCACTGCTGTGACACACACTGCTGCGTACATGCACTGCTG
END

RESULTS


     **********************************************************************
     *           We use the following releases of databases:              *
     *                                                                    *
     *            SwissProt:      Release 35 of November   1997           *
     *            Genbank:        weekly update                           * 
     *            Genome Sequence Database(GSDB-LANL): monthly update     * 
     *            PDB:            Release of Oct           1996           *
     *            Prosite:        Release 13.0 of December 1995           *
     *            dbEST:          Weekly update                           *
     *            Genpept:        Release of Dec           1997           *
     *            BLOCKS:         Release of May           1997           *
     *            Repetitive DNA: Release of December      1995           *
     **********************************************************************

, len = 345

*******PDB************PDB***********PDB************PDB************PDB*******

MATCHING SEQUENCES

The top 25 matching sequences             score
>1ERD PHEROMONE                             43
>1TFI TRANSCRIPTION REGULATION              33
>1TCA HYDROLASE(CARBOXYLIC ESTERASE)        33
>1RAL OXIDOREDUCTASE                        32
>1RAL OXIDOREDUCTASE                        32
>1GAT TRANSCRIPTION REGULATION              32
>2ABX POSTSYNAPTIC NEUROTOXIN               32
>1KBA TOXIN                                 31
>1NBT TOXIN                                 31
>1FUS HYDROLASE(ENDORIBONUCLEASE)           31
>1WSY LYASE(CARBON-OXYGEN)                  31
>1ATT SERINE PROTEINASE INHIBITOR           30
>1PDG GROWTH FACTOR                         30
>2LZM HYDROLASE (O-GLYCOSYL)                28
>1CHC VIRUS                                 28
>1FAS TOXIN                                 28
>1ENG HYDROLASE(GLYCOSIDASE)                28
>1PNH TOXIN                                 28
>1CHC VIRUS                                 28
>1GPD OXIDO-REDUCTSE(ALDEHYDE/DONR,NAD/A    28
>5ZNF ZINC FINGER DNA BINDING DOMAIN        27
>1EPS TRANSFERASE                           27
>1HUM CYTOKINE(CHEMOTACTIC)                 27
>1FD2 ELECTRON TRANSFER(IRON-SULFUR PROT    26
>1BNH RIBONUCLEASE INHIBITOR                26


Hit 1 >1ERD PHEROMONE 
Query:   12 SVCTAKVVVTHTAAYMHCXLRTRVXYAARRTAVCVHCKTSYCXHTLLRTCTAVTHTAAYM 71  
            .........................................:............::...:
Sbjct:    1 D-------------------------------------PMTCEQA-M---ASCEHT---M 15  

Query:   72 HCCDTHCCVHALLXHTLLRTCTAVTHTAAYMHCCDTHCCVHALL 115 
            ..:....:....:......::.....:.......:...:...:.
Sbjct:   16 --C-GY-C-QGPL---YM-TCIGI--T------TDPE-C--GLP 40  

Hit 2 >1TFI TRANSCRIPT
Query:   17 KVVVTHTAAYMHCXLRTRVXYAARRTAVCVHCKTSYCXHTLLRTCTAVTHTAAYMHCCDT 76  
            :...............:...........:..::...:..:........:...:.......
Sbjct:    1 K------TGG------TQTDLF-----TCGKCKKKNCTYTQVQ-----T-RSA------- 29  

Query:   77 HCCVHALLXHTLLRTCTAVTHTAAYMHCCDTHCCVHALL 115 
            ..........:....:............:..........
Sbjct:   30 ----DEPMT-TFV-VC-----NE-----C-GNR--WKFC 50  

Hit 3 >1TCA HYDROLASE(
Query:    1 SLCALQNVVLQSVCTAKVVVTHTAAYMHC-XLRTRV-------XYAA-----RRTAVC-- 44  
            ...::.............:.:..............:........:..........:::..
Sbjct:  159 TGSALTTALRNAGGLTQIVPTTNLYSATDEIVQPQVSNSPLDSSYLFNGKNVQAQAVCGP 218 

Query:   45 ---------VHCKTSY-CXHTLLRTCTAVTHTAAY----------MHCC-DTHCCVHALL 84  
            ..............::......::..:.....:.:......................:::
Sbjct:  219 LFVIDHAGSLTSQFSYVVGRSALRSTTGQARSADYGITDCNPLPANDLTPEQKVAAAALL 278 

Query:   85 XHTLLRTCTAVTHTA-----AY--MHCCDTH-CCVHALL 115 
            .....................:..........:......
Sbjct:  279 APAAAAIVAGPKQNCEPDLMPYARPFAVGKRTCSGIVTP 317 

Hit 4 >1RAL OXIDOREDUC
Query:    1 SLCALQNVVLQSV-C-TAKVV-VTHTAAY-----MHC-XLRT-RV--XYAAR----RTAV 44  
            ..:..............::...:................:....:...............
Sbjct:  143 DICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKM 202 

Query:   45 CVHCKT------SYCXHTLLRTCTAVTH-TA---------AYMHCCD-THCCV---HALL 84  
            ...::.......:::.....:..:.:..............:.......:...:.....:.
Sbjct:  203 LDYCKSKDIILVSYCTLGSSRDKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQ 262 

Query:   85 XHT--LLRTCTA-----VTHTAAYMHCCDTHCCVHAL--------L 115 
            .....:.:...:......:.................:.........
Sbjct:  263 RGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNA 308 

Hit 5 >1RAL OXIDOREDUC Query: 1 SLCALQNVVLQSV-C-TAKVV-VTHTAAY-----MHC-XLRT-RV--XYAAR----RTAV 44 ..:..............::...:................:....:............... Sbjct: 143 DICDTWEAMEKCKDAGLAKSIGVSNFNCRQLERILNKPGLKYKPVCNQVECHLYLNQSKM 202 Query: 45 CVHCKT------SYCXHTLLRTCTAVTH-TA---------AYMHCCD-THCCV---HALL 84 ...::.......:::.....:..:.:..............:.......:...:.....:. Sbjct: 203 LDYCKSKDIILVSYCTLGSSRDKTWVDQKSPVLLDDPVLCAIAKKYKQTPALVALRYQLQ 262 Query: 85 XHT--LLRTCTA-----VTHTAAYMHCCDTHCCVHAL--------L 115 .....:.:...:......:.................:......... Sbjct: 263 RGVVPLIRSFNAKRIKELTQVFEFQLASEDMKALDGLNRNFRYNNA 308
Hit 6 >1GAT TRANSCRIPT
Query:   34 RVXYAARRTAVCVHCKTSYCXHTLLRTCTAVTHTAAYMHCCDTHCCVHALLXHTLLRTCT 93  
            ......:...::..:.::.............:.:...........:....:...:.....
Sbjct:    1 K-----RAGTVCSNCQTS-------------TTTLWRRSPMGDPVCNACGLYYKLHQVNR 42  

Query:   94 AVTHTAAYMHCCDTHCCVHALL 115 
            ..:..............:....
Sbjct:   43 PLTMRKDGIQTRNRK--V-SS- 60  

Hit 7 >2ABX POSTSYNAPT
Query:   43 AVCVHCKTSYCXHTLLRTCTAVTHTAAYMHCCDTHCCVHALLXHTLLRTCTAVTHTAAYM 102 
            .::.:..:.........::............::..:........................
Sbjct:    1 IVC-HT-TATIPSSAV-TCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEV 57  

Query:  103 HCCDTHCCVH---ALL- 115 
            .::.:..:.:.......
Sbjct:   58 TCCSTDKCNHPPKRQPG 74  

Hit 8 >1KBA TOXIN     
Query:   25 AYMHCXLRTRVXYAARRTAVCVHCKTSYCXHTLLRTCTAVTHTAAYMHCCDTHCCVHA-L 83  
            ....:..................:............:.......:....::..:......
Sbjct:    1 R-T-C---L-I---S-PSSTPQTC--P--NGQDI--CFLK----AQ---CDKFCSIRGPV 37  

Query:   84 LXHTLLRTCTAVTHTAAYMHCCDTHCCVHALL 115 
            .......::...........::.:..:.:...
Sbjct:   38 IEQGCVATCPQFRSNYRSLLCCTTDNCNH--- 66  

Hit 9 >1NBT TOXIN     
Query:   25 AYMHCXLRTRVXYAARRTAVCVHCKTSYCXHTLLRTCTAVTHTAAYMHCCDTHCCVHA-L 83  
            ....:..................:............:.......:....::..:......
Sbjct:    1 R-T-C---L-I---S-PSSTPQTC--P--NGQDI--CFLK----AQ---CDKFCSIRGPV 37  

Query:   84 LXHTLLRTCTAVTHTAAYMHCCDTHCCVHALL 115 
            .......::...........::.:..:.:...
Sbjct:   38 IEQGCVATCPQFRSNYRSLLCCTTDNCNH--- 66  

Hit 10 >1FUS HYDROLASE(E
Query:    4 ALQNVVLQSVCTAKVVVTHTAAYMHCXLRTRVXYAARRTAVCVHCKTSYCXHTLLRTCTA 63  
            :.......:.......:...::...:.................:....:...........
Sbjct:    1 A-SATTCGSTNYSASQV-RAAANAACQYY-Q-NDDTAGSSTYPHTYNNYEGFDFPVDGPY 56  

Query:   64 VTHTAAYMHCCDTHC-CVHALLXHTLLRTCTAVTHT-AA---YMHCCDTHCCVHALL 115 
            ........................:......:.:::.:.......:..:........
Sbjct:   57 QEFPIKSGGVYTGGSPGADRVVINTNCEYAGAITHTGASGNNFVGCSGT----N--- 106 

Hit 11 >1WSY LYASE(CARBO
Query:    1 S-LCALQNVV----L-Q-SVC--TAKV-VV-THT--------AAY-M-HCX-L-RTRVXY 37  
            :.:.:...:.......:.......:.................:.:.......:.:..:..
Sbjct:  125 SVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTG 184 

Query:   38 AARRTAV----CVH-CKTSYCXHTLLRT-CTAVTHTAAYMHCCDTHCCVHALLXHTLLRT 91  
            :..:.:..........:.......:............:......................
Sbjct:  185 AENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKN 244 

Query:   92 CTAVTHTAAYMHCCDTHCCVHALL 115 
            ........:...............
Sbjct:  245 LASPKQMLAELRSFVSAMKAASRA 268 

Hit 12 >1ATT SERINE PROT
Query:    1 SLCALQNVVLQ---SV----CTAKVVVTHTA-AYMHCXLRTRVXYAA-R--R-TAVCVHC 47  
            :.....:.............:............:......:.:..........:.:....
Sbjct:  219 SKFSPENTRKELFYKADGESCSVLMMYQESKFRYRRVAESTQVLELPFKGDDITMVLILP 278 

Query:   48 ---KTSYCXH-------------TLLRTCTAVTHTAAYMH-------------------- 71  
            ...::...................:..:...:............................
Sbjct:  279 KLEKTLAKVEQELTPDMLQEWLDELTETLLVVHMPRFRIEDSFSVKEQLQDMGLEDLFSP 338 

Query:   72 --------CCDTHCCVH-ALLXH-TLL---------RTCTAVTHTAAYMH---------- 102 
            ......................:...:............:....................
Sbjct:  339 EKSRLPGIVAEGRSDLYVSDAFHKAFLEVNEEGSEAAASTVISIAGRSLRVTFKANRPFL 398 

Query:  103 ------CCDTHCC----VH-ALL 115 
            .........:.............
Sbjct:  399 VLIREVALNTIIFMGRVANPCVD 421 

Hit 13 >1PDG GROWTH FACT
Query:    1 SLCALQNVVLQSVCTAKVVVTHTAAYMHCXLRTRVXYAARRTAVCVHCKTSYCXHTL-LR 59  
            :........:.:...........:....:..::.:....::...................
Sbjct:    1 S--------LGSL-----TIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQ 47  

Query:   60 TCTAVTHTAAYMHCCDTHC--------CVHALLXHTLLRTCTAVTHTAAYMHC-CDTHCC 110 
            .:...........:..:........................:.::.......:.:.:...
Sbjct:   48 RCSGCCNN-RNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKAT-VTLED-HLACKCETVAA 104 

Query:  111 VHALL 115 
            .....
Sbjct:  105 ARPVT 109 

Hit 14 >2LZM HYDROLASE (
Query:    1 SLCALQNVVLQSVCTAKVVVTHTAAYMHCXLRTRVXYAARRTAVCVHCKTSYCXHTLLRT 60  
            ::.:...............:..............:..:.:........:..:......:.
Sbjct:   38 SLNAAKSELDKAIGRNCNGVITKDEA-EKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRR 96  

Query:   61 C-----------TAVTHTAAYMHCCDTHCCVHALLXHTLLRTCTAVTHTAAYMHCC--DT 107 
            :...........:.:.................:.......:........:..........
Sbjct:   97 CALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTG 156 

Query:  108 HCCVHALL 115 
            .......:
Sbjct:  157 TWDAYKNL 164 

Hit 15 >1CHC VIRUS      
Query:   35 VXYAARRTAVCVHCKTSYCXHTLLRTCTAVTHTAAYMHCCDTHCCVHALLXHTLLRTCTA 94  
            ....:.:...:......:...................:.....:.............:..
Sbjct:    1 MATVAERCPICLEDPSNY------------SMALPCLHAFCYVCITRWIRQNPTCPLCKV 48  

Query:   95 VTHTAAYMHCCDTHCCVHALL 115 
            ...........:.......:.
Sbjct:   49 PVESVVHTIESDSE-FGDQLI 68

Hit 16 >1FAS TOXIN      
Query:   42 TAVCVHCKTSYCXHTLLRTCTAVTHTAAYMHCCDTHCCVHALLXHTLLRTCTAVTHTAAY 101 
            :.....:......:.........:...:....:....:......:...............
Sbjct:    1 TM----C----YSH--------TTTSRAILTNCGENSCYRKSRRHPPKMVLGRGCGCPPG 44  

Query:  102 MHCCDTHCCV---HALL 115 
            .......::........
Sbjct:   45 DDYLEVKCCTSPDKCNY 61  

Hit 17 >1ENG HYDROLASE(G
Query:    1 SLCALQNVVLQSVCTAKVVVTHTAAYMHCXLRTRVXYAARRTAVCVHC------------ 47  
            :.:....:...........:....:.............:.....:...............
Sbjct:   45 SGCEPGGVAYSCADQTPWAVNDDFALGFAATSIAGSNEAGWCCACYELTFTSGPVAGKKM 104 

Query:   48 ---KTSYC------XHTLLRT---------CTAVTHTA-A--YM---------HCCD-TH 76  
            ....::...........:............::..........:.............:...
Sbjct:  105 VVQSTSTGGDLGSNHFDLNIPGGGVGIFDGCTPQFGGLPGQRYGGISSRNECDRFPDALK 164 

Query:   77 --CCVH----ALLXH---TLLR-TCTAVTHTAAYMHC-CDTHCCVHALL 115 
            ..:.....................:.:............:.........
Sbjct:  165 PGCYWRFDWFKNADNPSFSFRQVQCPAELVARTGCRRNDDGNFPAVQIP 213 

Hit 18 >1PNH TOXIN      
Query:   50 TSYCXHTLLRTCTAVTHTAAYMHCCDTHCCVHALLXHTLLRTCTAVTHTAAYMHCCDTHC 109 
            :..:....::...................:........::..:..:..............
Sbjct:    1 TV-C--N-LR-----------------R-CQLSCRSLGLLGKCIGV----------KCE- 27  

Query:  110 CVHALL 115 
            ::....
Sbjct:   28 CVKH-- 31 

Hit 19 >1CHC VIRUS      
Query:   35 VXYAARRTAVCVHCKTSYCXHTLLRTCTAVTHTAAYMHCCDTHCCVHALLXHTLLRTCTA 94  
            ....:.:...:......:...................:.....:.............:..
Sbjct:    1 MATVAERCPICLEDPSNY------------SMALPCLHAFCYVCITRWIRQNPTCPLCKV 48  

Query:   95 VTHTAAYMHCCDTHCCVHALL 115 
            ...........:.......:.
Sbjct:   49 PVESVVHTIESDSE-FGDQLI 68  

Hit 20 >1GPD OXIDO-REDUC
Query:    1 S---LCALQNVVLQ-SVC--T---------------A-KVVV--THTAAYMHC---XL-- 30  
            .......:...:........:...............:.......:..:.........:..
Sbjct:  164 NFEIVEGLMTTVHAVTATQKTVDGPSAKDWRGGRGAAQNIIPSSTGAAKAVGKVIPELDG 223 

Query:   31 -RTRVXYAARRT---AVCVHCKTS-YCXHTLLRTCTAVT----------HT------AAY 70  
            ..:.............:.........:.......................:.........
Sbjct:  224 KLTGMAFRVPTPDVSVVDLTVRLGKECSYDDIKAAMKTASEGPLQGFLGYTEDDVVSSDF 283 

Query:   71 MHCCDTHCCV-HA-L-LXHTLLRTCTAVTHTAAYM-HCCD--THCCVHALL 115 
            ............:...:..:.............:.....:...:.......
Sbjct:  284 IGDNRSSIFDAKAGIQLSKTFVKVVSWYDNEFGYSQRVIDLLKHMQKVDSA 334 

Hit 21 >5ZNF ZINC FINGER
Query:   59 RTCTAVTHTAAYMHCCDTHCCVHALLXHTLLRTCTAVTHTAAYMHCCDTHCCVHALL 115 
            ...............:....:.........:........:....:....:.......
Sbjct:    1 K-----------TYQC-QY-CEYRSADSSNLK-------T----HIKTKHS--KE-K 30

Hit 22 >1EPS TRANSFERASE
Query:    1 S--LC-----------------ALQN------VV--L-QSVCTA-K-VVVTH---TAAY- 25  
            :..:....................:.......:........:........:.....:...
Sbjct:  247 SYFLAAAAIKGGTVKVTGIGRNSMQGDIRFADVLEKMGATICWGDDYISCTRGELNAIDM 306 

Query:   26 ----M-HC--XLRTRVXYAARRTAVC-V---HC-KTS--YCXHTLLRTCTAVTHTAA-YM 71  
            .............:....:...:............:.......:.::...:.......:.
Sbjct:  307 DMNHIPDAAMTIATAALFAKGTTRLRNIYNWRVKETDRLFAMATELRKVGAEVEEGHDYI 366 

Query:   72 HCCDT------H-CCV--HALLXHTLLRTCTAVTHTAAYMHC-CDTHC------C-VHAL 114 
            ..................:.......:........:.....:...:..............
Sbjct:  367 RITPPEKLNFAEIATYNDHRMAMCFSLVALSDTPVTILDPKCTAKTFPDYFEQLARISQA 426 

Query:  115 L 115 
            .
Sbjct:  427 A 427 

Hit 23 >1HUM CYTOKINE(CH
Query:   39 ARRTAVCVHCKTSYCXHTLLRTCTAVTHTAAYMHCCDTHCCVHALLXHTLLRTCTAVTHT 98  
            :..........:..:.....:..........:.......:...:....:...........
Sbjct:    1 APMGSD--P-PTACCFSYTARKLPR-NFVVDYYETSSL-CSQPAVVFQTKRSKQVCADPS 55  

Query:   99 AAYMHCCDTHCCVHALL 115 
            ...............:.
Sbjct:   56 ESWVQEYVYD--LE-LN 69  

Hit 24 >1FD2 ELECTRON TR
Query:   16 AKVVVTHTAAYMHCXLRTRVXYAARRTAVCVHCKTSYCXHTLLRTC------TAVTHTAA 69  
            :..:::.......................:..::...:.......:........:.:...
Sbjct:    1 AF-VVTDN---------------------CIKCKYTDCVEVAPVDCFYEGPNFLVIHPDE 38  

Query:   70 YMHC--CDTHC---CVHA-----------L-LXHTLLRTCTAVTHTAAYM-HCCDTHCCV 110 
            ...:..:...:....................:...:.......:..........:.....
Sbjct:   39 CIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVK 98  

Query:  111 ----HALL 115 
            ....:...
Sbjct:   99 GKLQHLER 106 

Hit 25 >1BNH RIBONUCLEAS
Query:    1 SLC-ALQNV-VL-Q-SVCTAK-----V-VVTHTAAYMHCXLRTR-VXYAARRTAVC---- 44  
            .::..::....:...:....:.................:.:....:.......:.:....
Sbjct:  270 DLCRVLQAKETLKELSLAGNKLGDEGARLLCESLLQPGCQLESLWVKSCSLTAACCQHVS 329 

Query:   45 ---V---H-CKTSYCXH----T----LLRTCTAV--THTAAYM------H--CCDTHCC- 78  
            .......:..................:.........:...............:.......
Sbjct:  330 LMLTQNKHLLELQLSSNKLGDSGIQELCQALSQPGTTLRVLCLGDCEVTNSGCSSLASLL 389 

Query:   79 -VH-A---L-LXHT------LLRTCTAVTHT-AAYMH-CC-DTHCC-------------- 109 
            ........:.:..........:...........:.......::.................
Sbjct:  390 LANRSLRELDLSNNCVGDPGVLQLLGSLEQPGCALEQLVLYDTYWTEEVEDRLQALEGSK 449 

Query:  110 --VHALL 115 
            .......
Sbjct:  450 PGLRVIS 456 


*******PDB************PDB***********PDB************PDB************PDB*******