INPUT QUERY

TYPE	DNA
TARGET	PDB
METHOD	SW -G 13 
MATRIX	BLOSUM 62 
SCORE	25 
ALIGN	25 
SEQ
AGTCTGTGTGCACTGCAAAACGTCGTACTGCAGTCTGTGTGCACTGCAAAAGTCGTCGTGACACACACTGCT
GCGTACATGCACTGCTGACTGCGTACGAGAGTCTGATATGCTGCACGTCGTACTGCAGTCTGTGTGCACTGC
AAAACGTCGTACTGCTGACACACACTGCTGCGTACATGCACTGCTGTGACACACACTGCTGCGTACATGCAC
TGCTGTGACACACACTGCTGCGTACATGCACTGCTGTGACACACACTGCTGCGTACATGCACTGCTGTGACA
CACACTGCTGCGTACATGCACTGCTGTGACACACACTGCTGCGTACATGCACTGCTG
END

RESULTS


     **********************************************************************
     *           We use the following releases of databases:              *
     *                                                                    *
     *            SwissProt:      Release 35 of November   1997           *
     *            Genbank:        weekly update                           * 
     *            Genome Sequence Database(GSDB-LANL): monthly update     * 
     *            PDB:            Release of Oct           1996           *
     *            Prosite:        Release 13.0 of December 1995           *
     *            dbEST:          Weekly update                           *
     *            Genpept:        Release of Dec           1997           *
     *            BLOCKS:         Release of May           1997           *
     *            Repetitive DNA: Release of December      1995           *
     **********************************************************************

, len = 345

*******PDB************PDB***********PDB************PDB************PDB*******

MATCHING SEQUENCES

The top 25 matching sequences             score
>1ERD PHEROMONE                             43
>1TFI TRANSCRIPTION REGULATION              33
>1TCA HYDROLASE(CARBOXYLIC ESTERASE)        33
>1RAL OXIDOREDUCTASE                        32
>1RAL OXIDOREDUCTASE                        32
>1GAT TRANSCRIPTION REGULATION              32
>2ABX POSTSYNAPTIC NEUROTOXIN               32
>1KBA TOXIN                                 31
>1NBT TOXIN                                 31
>1FUS HYDROLASE(ENDORIBONUCLEASE)           31
>1WSY LYASE(CARBON-OXYGEN)                  31
>1ATT SERINE PROTEINASE INHIBITOR           30
>1PDG GROWTH FACTOR                         30
>2LZM HYDROLASE (O-GLYCOSYL)                28
>1CHC VIRUS                                 28
>1FAS TOXIN                                 28
>1ENG HYDROLASE(GLYCOSIDASE)                28
>1PNH TOXIN                                 28
>1CHC VIRUS                                 28
>1GPD OXIDO-REDUCTSE(ALDEHYDE/DONR,NAD/A    28
>5ZNF ZINC FINGER DNA BINDING DOMAIN        27
>1EPS TRANSFERASE                           27
>1HUM CYTOKINE(CHEMOTACTIC)                 27
>1FD2 ELECTRON TRANSFER(IRON-SULFUR PROT    26
>1BNH RIBONUCLEASE INHIBITOR                26


Hit 1 >1ERD PHEROMONE 
Query:   36 X-Y-AARRTAVCVHCKTSYCXHTLLRTCTAVT 65  
            .........:.:.:....::...:..::...:
Sbjct:    1 DPMTCEQAMASCEHTMCGYCQGPLYMTCIGIT 32  

Hit 2 >1TFI TRANSCRIPT
Query:   34 RVXYAARRTAVCVHCKTSYCXHTLLRTCTAVTHTAAYMHC 73  
            ...........:..::...:..:...:..:.........:
Sbjct:    1 KTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVC 40 

Hit 3 >1TCA HYDROLASE(
Query:    2 LCALQNVVLQSVCTAKVVVTHTAAYMHCXLRTRVXYAARRTAV 44  
            :....::..:.::....:..:.:......:.....:...:.:.
Sbjct:  204 LFNGKNVQAQAVCGPLFVIDH-AGS----LTSQFSYVVGRSAL 241 

Hit 4 >1RAL OXIDOREDUC
Query:    1 SLCALQNVVLQSVCT 15  
            ..:......:.:.::
Sbjct:  204 DYCKSKDIILVSYCT 218 

Hit 5 >1RAL OXIDOREDUC
Query:    1 SLCALQNVVLQSVCT 15  
            ..:......:.:.::
Sbjct:  204 DYCKSKDIILVSYCT 218 

Hit 6 >1GAT TRANSCRIPT
Query:   39 ARRTAVCVHCKTS 51  
            .:...::..:.::
Sbjct:    1 KRAGTVCSNCQTS 13  

Hit 7 >2ABX POSTSYNAPT
Query:   46 VHCKTSYCXHTLLRTCTAVTHTAAYMHCCDTHCCVHALLXHTLLRTCTAVTHTAAYMHCC 105 
            ..:.:.........::............::..:.........................::
Sbjct:    1 IVCHTTATIPSSAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCC 60  

Query:  106 DTHCCVH 112 
            .:..:.:
Sbjct:   61 STDKCNH 67  

Hit 8 >1KBA TOXIN     
Query:   53 CXHTLLRTC-TAVTHTA-AYMHC-CDTHCCVHA-LLXHTLLRTCTAVTHTAAYMHCCDTH 108 
            :......:..:.............::..:.............::...........::.:.
Sbjct:    3 CLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTD 62  

Query:  109 CCVH 112 
            .:.:
Sbjct:   63 NCNH 66  

Hit 9 >1NBT TOXIN     
Query:   53 CXHTLLRTC-TAVTHTA-AYMHC-CDTHCCVHA-LLXHTLLRTCTAVTHTAAYMHCCDTH 108 
            :......:..:.............::..:.............::...........::.:.
Sbjct:    3 CLISPSSTPQTCPNGQDICFLKAQCDKFCSIRGPVIEQGCVATCPQFRSNYRSLLCCTTD 62  

Query:  109 CCVH 112 
            .:.:
Sbjct:   63 NCNH 66  

Hit 10 >1FUS HYDROLASE(E
Query:    1 SLCALQNVVLQSVCTAKVVVTHTAA 25  
            :......::....:......:::.:
Sbjct:   71 SP-GADRVVINTNCEYAGAITHTGA 94  

Hit 11 >1WSY LYASE(CARBO
Query:    2 LCALQNVVLQSVCTAKVVVTHTAAYMHCXLRTRV 35  
            ......:...::..:.:.:...:......::...
Sbjct:  115 YARCEQVGVDSVLVADVPVEESAPFRQAALRHNI 148 

Hit 12 >1ATT SERINE PROT
Query:   10 LQSVCTAK 17  
            ...:::::
Sbjct:    1 VEDVCTAK 8   

Hit 13 >1PDG GROWTH FACT
Query:   14 CTAKVVVTHTAAYMHCXLRTRVXYAARR 41  
            ..........:....:..::.:....::
Sbjct:    1 SLGSLTIAEPAMIAECKTRTEVFEISRR 28  

Hit 14 >2LZM HYDROLASE (
Query:    1 SLCALQNVVLQ 11  
            ..:::.:.:.:
Sbjct:   96 R-CALINMVFQ 105

Hit 15 >1CHC VIRUS      
Query:   35 VXYAARRTAVCVHCKTSY-----CXHTLLRTC 61  
            ....:.:...:......:.....:.:.....:
Sbjct:    1 MATVAERCPICLEDPSNYSMALPCLHAFCYVC 32  

Hit 16 >1FAS TOXIN      
Query:   76 THCCVHALLXHTLLRTC 92  
            :.:..:.......:..:
Sbjct:    1 TMCYSHTTTSRAILTNC 17  

Hit 17 >1ENG HYDROLASE(G
Query:   63 AVTHTAAYMHCCDTHC 78  
            :......:..::...:
Sbjct:    1 ADGRSTRYWDCCKPSC 16  

Hit 18 >1PNH TOXIN      
Query:   67 TAAYMHCCDTHCCVHALLXHTLLRTCTAVTH 97  
            :......:...:....::.......:..:.:
Sbjct:    1 TVCNLRRCQLSCRSLGLLGKCIGVKCECVKH 31  

Hit 19 >1CHC VIRUS      
Query:   35 VXYAARRTAVCVHCKTSY-----CXHTLLRTC 61  
            ....:.:...:......:.....:.:.....:
Sbjct:    1 MATVAERCPICLEDPSNYSMALPCLHAFCYVC 32  

Hit 20 >1GPD OXIDO-REDUC
Query:    1 SLCALQNVVLQSVCTAKVV 19  
            ...:.::....:...::.:
Sbjct:  198 G--AAQNIIPSSTGAAKAV 214 

Hit 21 >5ZNF ZINC FINGER
Query:   41 RTAVCVHCKTSYCXHTLLRTCTAVTHT 67  
            .:..:..:.........:.:.....:.
Sbjct:    1 KTYQCQYCEYRSADSSNLKTHIKTKHS 27  

Hit 22 >1EPS TRANSFERASE
Query:    1 SLCALQN---VVLQSVCTAK 17  
            ::.::.......:...::::
Sbjct:  392 SLVALSDTPVTILDPKCTAK 411 

Hit 23 >1HUM CYTOKINE(CH
Query:    1 SLCALQNVVLQS 12  
            :::....::.:.
Sbjct:   33 SLCSQPAVVFQT 44  

Hit 24 >1FD2 ELECTRON TR
Query:   38 AARRTAVCVHCKTSYC 53  
            :...:..:..::...:
Sbjct:    1 AFVVTDNCIKCKYTDC 16  

Hit 25 >1BNH RIBONUCLEAS
Query:    1 SLCALQNVVL 10  
            ..:::...::
Sbjct:  421 G-CALEQLVL 429 


*******PDB************PDB***********PDB************PDB************PDB*******